PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 327681
Common NameARALYDRAFT_327681
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 573aa    MW: 64003.8 Da    PI: 8.045
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
327681genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.84.1e-37340398260
  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
             +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  327681 340 PQEPRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 398
             67899****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF050976.6E-622225IPR007789Protein of unknown function DUF688
ProDomPD0074782.0E-27339394IPR003851Zinc finger, Dof-type
PfamPF027012.2E-32342398IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.444344398IPR003851Zinc finger, Dof-type
PROSITE patternPS013610346382IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MEAEKETEQE GNLSVMILPV LPIKPNTHSH SMSSPIHSSI SASVPFSWEE EPGKPKQHSS  60
SSSSSSSSSP LTSYSSSPFE THKSLELPPR LHLLEKDGGS VTKLHSPITV FDGPYSMTRS  120
KRMDSPSFRM MVKGSADCYG SFRSDIYGDL DDVEVDSKQQ ENLSSVSLAI VKKRGRLGFF  180
GFRRRRALKG KTEFGRGSYV FPSSVDRESE YSRKEEEEVK EDKSFGYGDG DGISCSHSSR  240
FCEVTMTSSI SRTGSFSTLP APTSSSSKSH FWVTHIMDHH QYHHHDQYQH QMNITNNNPY  300
NTIVTTQPPP PTTTTMDSTT ATTMIMDDEK KLMTTMSTRP QEPRNCPRCN SSNTKFCYYN  360
NYSLAQPRYL CKSCRRYWTE GGSLRNVPVG GGSRKNKKLP LLLPNSSTSS STKNLPDLNP  420
PFVFTSSPSS SNPNKTHQNN NDLSLSFSSP MQDKRAQGHY SHFTDQVVTG GQNCLFQAPM  480
GMIQFRQEYD HDHQKKNLGF SLDRNKEEIG NHGNFVVNGE GSKIMYPYGD HEDRHQHHHV  540
RHDDGNKKRE GGSSNELWSG IILGGDSGGP TW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171185KKRGRLGFFGFRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1614910.0AL161491.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 3.
GenBankCP0026870.0CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankTM018A100.0AF013294.1 Arabidopsis thaliana BAC TM018A10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872917.10.0hypothetical protein ARALYDRAFT_327681
TrEMBLD7M5060.0D7M506_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60029010.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.11e-136Dof family protein